General Information

  • ID:  hor005271
  • Uniprot ID:  P68006
  • Protein name:  Neuropeptide Y
  • Gene name:  NPY
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0031410 cytoplasmic vesicle; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
  • Length:  36(1-36)
  • Propeptide:  YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPY1R, NPY2R
  • Target Unid:   B6VRS4, G1TSD5
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  ~ 20 (20-28) minutes; /1200 seconds ( PubMed ID: 3601235 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P68006-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P68006-F1.pdbhor005271_AF2.pdbhor005271_ESM.pdb

Physical Information

Mass: 489718 Formula: C189H284N54O58S
Absent amino acids: CFVW Common amino acids: Y
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -119.44 Boman Index: -10835
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 54.44
Instability Index: 6373.89 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  3368580##3601235
  • Title:  Neuropeptide Y in guinea pig, rabbit, rat and man. Identical amino acid sequence and oxidation of methionine-17.